SCOP 1.63: Domain d1dqdh2: 1dqd H:123-222

Lineage for d1dqdh2 (1dqd H:123-222)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab HGR-2 F6, (mouse), kappa L chain [49100] (1 PDB entry)
   a competitive antagonist of the glucagon receptor

8. Domain d1dqdh2: 1dqd H:123-222 [21407]
   Other proteins in same PDB: d1dqdh1, d1dqdl1

Details for d1dqdh2

PDB Entry: 1dqd, 2.1 Å

PDB Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor

SCOP Domain Sequences for d1dqdh2:

Sequence, based on SEQRES records:

>d1dqdh2 b.1.1.2 (H:123-222) Immunoglobulin (constant domains of L and H chains) {Fab HGR-2 F6, (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg

Sequence, based on observed residues (ATOM records):

>d1dqdh2 b.1.1.2 (H:123-222) Immunoglobulin (constant domains of L and H chains) {Fab HGR-2 F6, (mouse), kappa L chain}
akttppsvyplapgsaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg

Timeline for d1dqdh2:

• d1dqdh2 first appeared (with stable ids) in SCOP 1.55
  
• d1dqdh2 appears in SCOP 1.61
  
• d1dqdh2 appears in SCOP 1.65
  
• d1dqdh2 appears in the current release, SCOPe 2.08