PDB entry 1dqd

View 1dqd on RCSB PDB site
Description: crystal structure of fab hgr-2 f6, a competitive antagonist of the glucagon receptor
Deposited on 2000-01-04, released 2000-05-10
The last revision prior to the SCOP 1.63 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1dqdH (H:)
    evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
    pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
    ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
    sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dqdH (H:)
    evqlqesgpslvkpsqtlsltcsvtgdsitsgywnwirkfpgnkleymgyisysgstyyn
    pslksrlsitrdtsrnqyylqlksvtpedtatyycasppgyygsgpyamdywgqgtsvtv
    ssakttppsvyplapgsaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkispg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dqdL (L:)
    divlsqspaimsaspgekvtitcsasssvsymhwfqqkpgtspklciyttsnlasgvpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypptfgsgtkleikradaaptvsifpps
    seqltsggasvvcflnnfyprdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrneca