SCOP 1.57: Domain d1adqh2: 1adq H:114-223B

Lineage for d1adqh2 (1adq H:114-223B)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species IgM rheumatoid factor Fab (human), lambda L chain [49067] (1 PDB entry)

8. Domain d1adqh2: 1adq H:114-223B [21273]
   Other proteins in same PDB: d1adqh1, d1adql1

Details for d1adqh2

PDB Entry: 1adq, 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqh2:

Sequence; same for both SEQRES and ATOM records:

>d1adqh2 b.1.1.2 (H:114-223B) Immunoglobulin (constant domains of L and H chains) {IgM rheumatoid factor Fab (human), lambda L chain}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvmqgtnehvvckvqhpngnkekdvpl

Timeline for d1adqh2:

• d1adqh2 first appeared (with stable ids) in SCOP 1.55
  
• d1adqh2 appears in SCOP 1.59
  
• d1adqh2 appears in the current release, SCOPe 2.08