Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fc (human) IgG1 class [49120] (8 PDB entries) |
Domain d1adqa2: 1adq A:342-443 [21519] Other proteins in same PDB: d1adqh1, d1adql1 |
PDB Entry: 1adq (more details), 3.15 Å
SCOP Domain Sequences for d1adqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adqa2 b.1.1.2 (A:342-443) Immunoglobulin (constant domains of L and H chains) {Fc (human) IgG1 class} qprepqvytlppsqeemtknqvsltclvkgfypsdiavewesngqpennykttppvldsd gsfflysrltvdksrwqegnvfscsvmhealhnhytqkslsl
Timeline for d1adqa2:
View in 3D Domains from other chains: (mouse over for more information) d1adqh1, d1adqh2, d1adql1, d1adql2 |