Lineage for d1a6tc2 (1a6t C:108-211)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289708Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)
  8. 289826Domain d1a6tc2: 1a6t C:108-211 [21260]
    Other proteins in same PDB: d1a6ta1, d1a6tb1, d1a6tb2, d1a6tc1, d1a6td1, d1a6td2
    part of human rhinovirus 14 neutralizing Fab Mab1-IA

Details for d1a6tc2

PDB Entry: 1a6t (more details), 2.7 Å

PDB Description: fab fragment of mab1-ia monoclonal antibody to human rhinovirus 14 nim-ia site

SCOP Domain Sequences for d1a6tc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a6tc2 b.1.1.2 (C:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1a6tc2:

Click to download the PDB-style file with coordinates for d1a6tc2.
(The format of our PDB-style files is described here.)

Timeline for d1a6tc2: