Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab 2H1 (mouse), kappa L chain [49051] (1 PDB entry) |
Domain d2h1ph2: 2h1p H:421-520 [21207] Other proteins in same PDB: d2h1ph1, d2h1pl1 |
PDB Entry: 2h1p (more details), 2.4 Å
SCOP Domain Sequences for d2h1ph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1ph2 b.1.1.2 (H:421-520) Immunoglobulin (constant domains of L and H chains) {Fab 2H1 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr
Timeline for d2h1ph2: