SCOP 1.59: Domain d2h1ph2: 2h1p H:421-520

Lineage for d2h1ph2 (2h1p H:421-520)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab 2H1 (mouse), kappa L chain [49051] (1 PDB entry)

8. Domain d2h1ph2: 2h1p H:421-520 [21207]
   Other proteins in same PDB: d2h1ph1, d2h1pl1

Details for d2h1ph2

PDB Entry: 2h1p, 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes

SCOP Domain Sequences for d2h1ph2:

Sequence; same for both SEQRES and ATOM records:

>d2h1ph2 b.1.1.2 (H:421-520) Immunoglobulin (constant domains of L and H chains) {Fab 2H1 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d2h1ph2:

• d2h1ph2 first appeared (with stable ids) in SCOP 1.55
  
• d2h1ph2 appears in SCOP 1.57
  
• d2h1ph2 appears in SCOP 1.61
  
• d2h1ph2 appears in the current release, SCOPe 2.08