Lineage for d2h1ph1 (2h1p H:301-420)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102418Species Fab 2H1 (mouse), kappa L chain [48837] (1 PDB entry)
  8. 102419Domain d2h1ph1: 2h1p H:301-420 [20191]
    Other proteins in same PDB: d2h1ph2, d2h1pl2

Details for d2h1ph1

PDB Entry: 2h1p (more details), 2.4 Å

PDB Description: the three-dimensional structures of a polysaccharide binding antibody to cryptococcus neoformans and its complex with a peptide from a phage display library: implications for the identification of peptide mimotopes

SCOP Domain Sequences for d2h1ph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h1ph1 b.1.1.1 (H:301-420) Immunoglobulin (variable domains of L and H chains) {Fab 2H1 (mouse), kappa L chain}
dvklvesggglvklggslklscaasgftfssyflswvrqtpekrlelvatinsngdktyh
pdtmkgrftisrdnakntlylqmsslksedtalyycarrdssaslyfdywgqgttltvss

SCOP Domain Coordinates for d2h1ph1:

Click to download the PDB-style file with coordinates for d2h1ph1.
(The format of our PDB-style files is described here.)

Timeline for d2h1ph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2h1ph2