![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
![]() | Species Fab H57 (hamster), lambda L chain [49050] (1 PDB entry) |
![]() | Domain d1nfde2: 1nfd E:108-215 [21202] Other proteins in same PDB: d1nfda1, d1nfda2, d1nfdb1, d1nfdb2, d1nfdc1, d1nfdc2, d1nfdd1, d1nfdd2, d1nfde1, d1nfdf1, d1nfdg1, d1nfdh1 |
PDB Entry: 1nfd (more details), 2.8 Å
SCOP Domain Sequences for d1nfde2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin (constant domains of L and H chains) {Fab H57 (hamster), lambda L chain} gpksspkvtvfppspeelrtnkatlvclvndfypgsatvtwkangatindgvkttkpskq gqnymtssylsltadqwkshnrvscqvthegetvekslspaecl
Timeline for d1nfde2: