SCOP 1.57: Domain d1nfdd1: 1nfd D:1-117

Lineage for d1nfdd1 (1nfd D:1-117)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (11 PDB entries)

8. Domain d1nfdd1: 1nfd D:1-117 [20636]
   Other proteins in same PDB: d1nfda2, d1nfdb2, d1nfdc2, d1nfdd2, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2

Details for d1nfdd1

PDB Entry: 1nfd, 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

SCOP Domain Sequences for d1nfdd1:

Sequence; same for both SEQRES and ATOM records:

>d1nfdd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dsgvvqsprhiikekggrsvltcipisghsnvvwyqqtlgkelkfliqhyekverdkgfl
psrfsvqqfddyhsemnmsaleledsamyfcasslrwgdeqyfgpgtrltvle

Timeline for d1nfdd1:

• d1nfdd1 first appeared (with stable ids) in SCOP 1.55
  
• d1nfdd1 appears in SCOP 1.59
  
• d1nfdd1 appears in the current release, SCOPe 2.08