Lineage for d3ieua2 (3ieu A:183-296)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947226Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 2947289Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947290Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 2947291Protein GTPase Era C-terminal domain [54818] (3 species)
  7. 2947292Species Escherichia coli K-12 [TaxId:83333] [224928] (1 PDB entry)
  8. 2947293Domain d3ieua2: 3ieu A:183-296 [211618]
    Other proteins in same PDB: d3ieua1, d3ieub1
    automated match to d1egab2
    protein/RNA complex; complexed with gdp, so4, trs

Details for d3ieua2

PDB Entry: 3ieu (more details), 2.8 Å

PDB Description: crystal structure of era in complex with gdp
PDB Compounds: (A:) GTP-binding protein era

SCOPe Domain Sequences for d3ieua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ieua2 d.52.3.1 (A:183-296) GTPase Era C-terminal domain {Escherichia coli K-12 [TaxId: 83333]}
dyitdrsqrfmaseiireklmrflgaelpysvtveierfvsnerggydinglilveregq
kkmvignkgakiktigiearkdmqemfeapvhlelwvkvksgwadderalrslg

SCOPe Domain Coordinates for d3ieua2:

Click to download the PDB-style file with coordinates for d3ieua2.
(The format of our PDB-style files is described here.)

Timeline for d3ieua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ieua1