![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein GTPase Era, N-terminal domain [52637] (3 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [224886] (1 PDB entry) |
![]() | Domain d3ieub1: 3ieu B:4-182 [211619] Other proteins in same PDB: d3ieua2, d3ieub2 automated match to d1egab1 protein/RNA complex; complexed with gdp, so4, trs |
PDB Entry: 3ieu (more details), 2.8 Å
SCOPe Domain Sequences for d3ieub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ieub1 c.37.1.8 (B:4-182) GTPase Era, N-terminal domain {Escherichia coli K-12 [TaxId: 83333]} dksycgfiaivgrpnvgkstllnkllgqkisitsrkaqttrhrivgihtegayqaiyvdt pglhmeekrainrlmnkaasssigdvelvifvvegtrwtpddemvlnklregkapvilav nkvdnvqekadllphlqflasqmnfldivpisaetglnvdtiaaivrkhlpeathhfpe
Timeline for d3ieub1: