Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) |
Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
Protein T4 RNase H [47809] (1 species) |
Species Bacteriophage T4 [TaxId:10665] [47810] (6 PDB entries) |
Domain d3h8ja2: 3h8j A:183-305 [210908] Other proteins in same PDB: d3h8ja1 automated match to d1tfra1 complexed with na, so4 |
PDB Entry: 3h8j (more details), 1.8 Å
SCOPe Domain Sequences for d3h8ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3h8ja2 a.60.7.1 (A:183-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi nef
Timeline for d3h8ja2: