SCOP 1.67: Domain d1ncbl2: 1ncb L:109-214

Lineage for d1ncbl2 (1ncb L:109-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1ncbl2: 1ncb L:109-214 [21036]
   Other proteins in same PDB: d1ncbh1, d1ncbh2, d1ncbl1, d1ncbn_
   part of Fab NC41
   complexed with ca, man, nag; mutant

Details for d1ncbl2

PDB Entry: 1ncb, 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1ncbl2:

Sequence; same for both SEQRES and ATOM records:

>d1ncbl2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1ncbl2:

• d1ncbl2 first appeared (with stable ids) in SCOP 1.55
  
• d1ncbl2 appears in SCOP 1.65
  
• d1ncbl2 appears in SCOP 1.69
  
• d1ncbl2 appears in the current release, SCOPe 2.08