Lineage for d1ncbh1 (1ncb H:1-113)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362751Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 363225Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (29 PDB entries)
  8. 363237Domain d1ncbh1: 1ncb H:1-113 [19981]
    Other proteins in same PDB: d1ncbh2, d1ncbl1, d1ncbl2, d1ncbn_
    part of Fab NC41
    complexed with ca, man, nag; mutant

Details for d1ncbh1

PDB Entry: 1ncb (more details), 2.5 Å

PDB Description: crystal structures of two mutant neuraminidase-antibody complexes with amino acid substitutions in the interface

SCOP Domain Sequences for d1ncbh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglewmgwintntgepty
geefkgrfafsletsastanlqinnlknedkatffcargednfgslsdywgqgttltvss

SCOP Domain Coordinates for d1ncbh1:

Click to download the PDB-style file with coordinates for d1ncbh1.
(The format of our PDB-style files is described here.)

Timeline for d1ncbh1: