SCOP 1.65: Domain d1figh2: 1fig H:114-223

Lineage for d1figh2 (1fig H:114-223)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1figh2: 1fig H:114-223 [21017]
   Other proteins in same PDB: d1figh1, d1figl1, d1figl2
   part of catalytic antibody 1F7 with chorismate mutase activity
   complexed with tsa

Details for d1figh2

PDB Entry: 1fig, 3 Å

PDB Description: routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart

SCOP Domain Sequences for d1figh2:

Sequence; same for both SEQRES and ATOM records:

>d1figh2 b.1.1.2 (H:114-223) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

Timeline for d1figh2:

• d1figh2 first appeared (with stable ids) in SCOP 1.55
  
• d1figh2 appears in SCOP 1.63
  
• d1figh2 appears in SCOP 1.67
  
• d1figh2 appears in the current release, SCOPe 2.08