SCOP 1.55: Domain d1figh2: 1fig H:114-223

Lineage for d1figh2 (1fig H:114-223)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab 1F7 (mouse), kappa L chain [49003] (1 PDB entry)

8. Domain d1figh2: 1fig H:114-223 [21017]
   Other proteins in same PDB: d1figh1, d1figl1

Details for d1figh2

PDB Entry: 1fig, 3 Å

PDB Description: routes to catalysis: structure of a catalytic antibody and comparison with its natural counterpart

SCOP Domain Sequences for d1figh2:

Sequence; same for both SEQRES and ATOM records:

>d1figh2 b.1.1.2 (H:114-223) Immunoglobulin (constant domains of L and H chains) {Fab 1F7 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkki

Timeline for d1figh2:

• d1figh2 appears in SCOP 1.57
  
• d1figh2 appears in the current release, SCOPe 2.08