Lineage for d1gigl2 (1gig L:111-210)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2028905Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 2028990Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
    Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)
  8. 2029001Domain d1gigl2: 1gig L:111-210 [21004]
    Other proteins in same PDB: d1gigh1, d1gigh2, d1gigl1
    part of Fab HC19

Details for d1gigl2

PDB Entry: 1gig (more details), 2.3 Å

PDB Description: refined three-dimensional structure of the fab fragment of a murine igg1, lambda antibody
PDB Compounds: (L:) igg1-kappa hc19 fab (light chain)

SCOPe Domain Sequences for d1gigl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gigl2 b.1.1.2 (L:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOPe Domain Coordinates for d1gigl2:

Click to download the PDB-style file with coordinates for d1gigl2.
(The format of our PDB-style files is described here.)

Timeline for d1gigl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gigl1