Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (29 species) not a true protein |
Species Porphyromonas gingivalis [TaxId:431947] [225577] (1 PDB entry) |
Domain d3fi9b2: 3fi9 B:148-327 [209939] Other proteins in same PDB: d3fi9a1, d3fi9a3, d3fi9b1, d3fi9b3 automated match to d1hyea2 |
PDB Entry: 3fi9 (more details), 1.9 Å
SCOPe Domain Sequences for d3fi9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fi9b2 d.162.1.0 (B:148-327) automated matches {Porphyromonas gingivalis [TaxId: 431947]} lagldstrlqselakhfgikqslvtntrtygghgeqmavfastakvngtpltdligtdkl tneqwaelkqrvvkgganiiklrgrssfqspsyvsiemiraamggeafrwpagcyvnvpg fehimmamettitkdgvkhsdinqlgneaeraalkesyshlaklrdeviamgiipaiadw
Timeline for d3fi9b2: