Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Porphyromonas gingivalis [TaxId:431947] [225576] (1 PDB entry) |
Domain d3fi9a1: 3fi9 A:2-147 [209936] Other proteins in same PDB: d3fi9a2, d3fi9a3, d3fi9b2, d3fi9b3 automated match to d1hyea1 |
PDB Entry: 3fi9 (more details), 1.9 Å
SCOPe Domain Sequences for d3fi9a1:
Sequence, based on SEQRES records: (download)
>d3fi9a1 c.2.1.0 (A:2-147) automated matches {Porphyromonas gingivalis [TaxId: 431947]} sylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegln ltftsdikealtdakyivssggaprkegmtredllkgnaeiaaqlgkdiksycpdckhvi iifnpaditglvtliysglkpsqvtt
>d3fi9a1 c.2.1.0 (A:2-147) automated matches {Porphyromonas gingivalis [TaxId: 431947]} sylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegln ltftsdikealtdakyivssggtredllkgnaeiaaqlgkdiksycpdckhviiifnpad itglvtliysglkpsqvtt
Timeline for d3fi9a1: