SCOPe 2.06: Domain d3fi9a1: 3fi9 A:2-147

Lineage for d3fi9a1 (3fi9 A:2-147)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:431947] [225576] (1 PDB entry)

8. Domain d3fi9a1: 3fi9 A:2-147 [209936]
   Other proteins in same PDB: d3fi9a2, d3fi9a3, d3fi9b2, d3fi9b3
   automated match to d1hyea1

Details for d3fi9a1

PDB Entry: 3fi9, 1.9 Å

PDB Description: crystal structure of malate dehydrogenase from porphyromonas gingivalis

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3fi9a1:

Sequence, based on SEQRES records:

>d3fi9a1 c.2.1.0 (A:2-147) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
sylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegln
ltftsdikealtdakyivssggaprkegmtredllkgnaeiaaqlgkdiksycpdckhvi
iifnpaditglvtliysglkpsqvtt

Sequence, based on observed residues (ATOM records):

>d3fi9a1 c.2.1.0 (A:2-147) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
sylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegln
ltftsdikealtdakyivssggtredllkgnaeiaaqlgkdiksycpdckhviiifnpad
itglvtliysglkpsqvtt

Timeline for d3fi9a1:

• d3fi9a1 first appeared in SCOPe 2.03
  
• d3fi9a1 appears in SCOPe 2.05
  
• d3fi9a1 appears in SCOPe 2.07
  
• d3fi9a1 appears in the current release, SCOPe 2.08