Lineage for d3esfa2 (3esf A:86-197)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1904014Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225661] (1 PDB entry)
  8. 1904015Domain d3esfa2: 3esf A:86-197 [209621]
    Other proteins in same PDB: d3esfa1, d3esfb1, d3esfc1, d3esfd1
    automated match to d1jr9a2
    complexed with fe

Details for d3esfa2

PDB Entry: 3esf (more details), 2.01 Å

PDB Description: crystal structure of the enzyme fe-superoxide dismutase tbsodb2 from trypanosoma brucei
PDB Compounds: (A:) Iron-containing superoxide dismutase B2

SCOPe Domain Sequences for d3esfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3esfa2 d.44.1.0 (A:86-197) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ngggepsgklaeairasfgsfakfkeeftnaavghfgsgwawlvqdtttkklkvfqthda
gcplteadlkpiltcdvwehayyidykndrpayvqtfwnvvnwdhaenqftr

SCOPe Domain Coordinates for d3esfa2:

Click to download the PDB-style file with coordinates for d3esfa2.
(The format of our PDB-style files is described here.)

Timeline for d3esfa2: