Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225661] (1 PDB entry) |
Domain d3esfa2: 3esf A:86-197 [209621] Other proteins in same PDB: d3esfa1, d3esfb1, d3esfc1, d3esfd1 automated match to d1jr9a2 complexed with fe |
PDB Entry: 3esf (more details), 2.01 Å
SCOPe Domain Sequences for d3esfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3esfa2 d.44.1.0 (A:86-197) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} ngggepsgklaeairasfgsfakfkeeftnaavghfgsgwawlvqdtttkklkvfqthda gcplteadlkpiltcdvwehayyidykndrpayvqtfwnvvnwdhaenqftr
Timeline for d3esfa2: