Lineage for d2yv1a1 (2yv1 A:7-127)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830310Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 1830327Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species)
  7. 1830355Species Methanocaldococcus jannaschii [TaxId:243232] [225349] (1 PDB entry)
  8. 1830356Domain d2yv1a1: 2yv1 A:7-127 [207718]
    Other proteins in same PDB: d2yv1a2
    automated match to d1jkja1

Details for d2yv1a1

PDB Entry: 2yv1 (more details), 1.7 Å

PDB Description: Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
PDB Compounds: (A:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d2yv1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yv1a1 c.2.1.8 (A:7-127) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Methanocaldococcus jannaschii [TaxId: 243232]}
milldentkaivqgitgrqgsfhtkkmlecgtkivggvtpgkggqnvhgvpvfdtvkeav
ketdanasvifvpapfakdavfeaidagielivvitehipvhdtmefvnyaedvgvkiig
p

SCOPe Domain Coordinates for d2yv1a1:

Click to download the PDB-style file with coordinates for d2yv1a1.
(The format of our PDB-style files is described here.)

Timeline for d2yv1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yv1a2