SCOPe 2.05: Domain d2xhia2: 2xhi A:136-325

Lineage for d2xhia2 (2xhi A:136-325)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins)

6. Protein automated matches [227058] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226066] (1 PDB entry)

8. Domain d2xhia2: 2xhi A:136-325 [207255]
   Other proteins in same PDB: d2xhia1
   automated match to d1ebma1
   protein/DNA complex; complexed with ca; mutant

Details for d2xhia2

PDB Entry: 2xhi, 1.55 Å

PDB Description: Separation-of-function mutants unravel the dual reaction mode of human 8-oxoguanine DNA glycosylase

PDB Compounds: (A:) N-glycosylase/DNA lyase

SCOPe Domain Sequences for d2xhia2:

Sequence; same for both SEQRES and ATOM records:

>d2xhia2 a.96.1.3 (A:136-325) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah
lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtcvadkic
lmaldkpqavpvnvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq
avlfsadlrq

Timeline for d2xhia2:

• d2xhia2 first appeared in SCOPe 2.03
  
• d2xhia2 appears in SCOPe 2.04
  
• d2xhia2 appears in SCOPe 2.06
  
• d2xhia2 appears in the current release, SCOPe 2.08