Class a: All alpha proteins [46456] (289 folds) |
Fold a.96: DNA-glycosylase [48149] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.96.1: DNA-glycosylase [48150] (7 families) |
Family a.96.1.3: DNA repair glycosylase, 2 C-terminal domains [48157] (3 proteins) |
Protein automated matches [227058] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226066] (2 PDB entries) |
Domain d2xhia2: 2xhi A:136-325 [207255] Other proteins in same PDB: d2xhia1 automated match to d1ebma1 protein/DNA complex; complexed with ca; mutant |
PDB Entry: 2xhi (more details), 1.55 Å
SCOPe Domain Sequences for d2xhia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xhia2 a.96.1.3 (A:136-325) automated matches {Human (Homo sapiens) [TaxId: 9606]} dpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpeveah lrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtcvadkic lmaldkpqavpvnvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpyagwaq avlfsadlrq
Timeline for d2xhia2: