Lineage for d1b0ra1 (1b0r A:182-275)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2026191Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2026192Species Human (Homo sapiens) [TaxId:9606] [88605] (199 PDB entries)
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 2026469Domain d1b0ra1: 1b0r A:182-275 [20720]
    Other proteins in same PDB: d1b0ra2, d1b0rb2, d1b0rb3

Details for d1b0ra1

PDB Entry: 1b0r (more details), 2.9 Å

PDB Description: crystal structure of hla-a*0201 complexed with a peptide with the carboxyl-terminal group substituted by a methyl group
PDB Compounds: (A:) protein (hla-a*0201)

SCOPe Domain Sequences for d1b0ra1:

Sequence, based on SEQRES records: (download)

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Sequence, based on observed residues (ATOM records): (download)

>d1b0ra1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrqdtelvetrpagdgtfqkwaav
vvpsgqeqrytchvqheglpkpltlrwe

SCOPe Domain Coordinates for d1b0ra1:

Click to download the PDB-style file with coordinates for d1b0ra1.
(The format of our PDB-style files is described here.)

Timeline for d1b0ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ra2