Lineage for d2wr0a1 (2wr0 A:5-325)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776786Species Unidentified influenza virus [TaxId:11309] [225763] (9 PDB entries)
  8. 2776793Domain d2wr0a1: 2wr0 A:5-325 [206968]
    automated match to d1ha0a1
    complexed with nag

Details for d2wr0a1

PDB Entry: 2wr0 (more details), 2.45 Å

PDB Description: structures of influenza h2 hemagglutinins
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2wr0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wr0a1 b.19.1.0 (A:5-325) automated matches {Unidentified influenza virus [TaxId: 11309]}
dqicigyhannstekvdtilernvtvthakdilekthngklcrlsgipplelgdcsiagw
llgnpecdrllsvpewsyivekenpvnglcypgsfndyeelkhlitsvthfekvkilprd
qwtqhtttggsracavldnpsffrnmvwltkkgsnypiakrsynntsgeqmliiwgihhp
nddaeqrtlyqnvgtyvsvgtstlnkrsipeiatrpkvngqggrmefswtlletwdvinf
estgnliapeygfkiskrgssgimktektlencetkcqtplgainttlpfhnihpltige
cpkyvksdrlvlatglrnvpq

SCOPe Domain Coordinates for d2wr0a1:

Click to download the PDB-style file with coordinates for d2wr0a1.
(The format of our PDB-style files is described here.)

Timeline for d2wr0a1: