Lineage for d2wque1 (2wqu E:37-240)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851706Family c.10.2.1: Internalin LRR domain [52059] (4 proteins)
    capped at the N-end with a truncated EF-hand subdomain
    this is a repeat family; one repeat unit is 2omx A:261-239 found in domain
  6. 2851731Protein automated matches [226952] (2 species)
    not a true protein
  7. 2851736Species Listeria monocytogenes [TaxId:169963] [225326] (6 PDB entries)
  8. 2851746Domain d2wque1: 2wqu E:37-240 [206952]
    Other proteins in same PDB: d2wqua2, d2wqub2, d2wquc2, d2wqud2, d2wque2, d2wquf2
    automated match to d1m9sa5
    complexed with gol, so4

Details for d2wque1

PDB Entry: 2wqu (more details), 2.6 Å

PDB Description: internalin domain of listeria monocytogenes inlb: triclinic crystal form
PDB Compounds: (E:) internalin b

SCOPe Domain Sequences for d2wque1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wque1 c.10.2.1 (E:37-240) automated matches {Listeria monocytogenes [TaxId: 169963]}
titvptpikqifsddafaetikdnlkkksvtdavtqnelnsidqiiannsdiksvqgiqy
lpnvtklflngnkltdikplanlknlgwlfldenkvkdlsslkdlkklkslslehngisd
inglvhlpqleslylgnnkitditvlsrltkldtlslednqisdivplagltklqnlyls
knhisdlralaglknldvlelfsq

SCOPe Domain Coordinates for d2wque1:

Click to download the PDB-style file with coordinates for d2wque1.
(The format of our PDB-style files is described here.)

Timeline for d2wque1: