Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
Protein Biosynthetic thiolase, N-terminal domain [419020] (1 species) |
Species Zoogloea ramigera [TaxId:350] [419502] (16 PDB entries) Uniprot P07097 |
Domain d2vu2c1: 2vu2 C:4-268 [206474] Other proteins in same PDB: d2vu2a2, d2vu2b2, d2vu2c2, d2vu2d2 automated match to d1m4ta1 complexed with pn5, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2vu2 (more details), 2.65 Å
SCOPe Domain Sequences for d2vu2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vu2c1 c.95.1.1 (C:4-268) Biosynthetic thiolase, N-terminal domain {Zoogloea ramigera [TaxId: 350]} siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta gnasglndgaaaallmseaeasrrg
Timeline for d2vu2c1: