![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
![]() | Domain d1sbbc1: 1sbb C:3-117 [20629] Other proteins in same PDB: d1sbba2, d1sbbb1, d1sbbb2, d1sbbc2, d1sbbd1, d1sbbd2 |
PDB Entry: 1sbb (more details), 2.4 Å
SCOPe Domain Sequences for d1sbbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbbc1 b.1.1.1 (C:3-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} avtqsprnkvavtggkvtlscqqtnnhnnmywyrqdtghglrlihysygagstekgdipd gykasrpsqeqfslilelatpsqtsvyfcasgggrgsyaeqffgpgtrltvle
Timeline for d1sbbc1: