Lineage for d1sbbb1 (1sbb B:1-121)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2397830Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2398572Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2398594Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 2398595Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 2398620Domain d1sbbb1: 1sbb B:1-121 [25190]
    Other proteins in same PDB: d1sbba1, d1sbba2, d1sbbb2, d1sbbc1, d1sbbc2, d1sbbd2

Details for d1sbbb1

PDB Entry: 1sbb (more details), 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb
PDB Compounds: (B:) protein (staphylococcal enterotoxin b)

SCOPe Domain Sequences for d1sbbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbbb1 b.40.2.2 (B:1-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvte
h

SCOPe Domain Coordinates for d1sbbb1:

Click to download the PDB-style file with coordinates for d1sbbb1.
(The format of our PDB-style files is described here.)

Timeline for d1sbbb1: