Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.0: automated matches [227141] (1 protein) not a true family |
Protein automated matches [226843] (9 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [225339] (3 PDB entries) |
Domain d2vama2: 2vam A:209-315 [206283] Other proteins in same PDB: d2vama1 automated match to d1rq2a2 complexed with so4 |
PDB Entry: 2vam (more details), 2.5 Å
SCOPe Domain Sequences for d2vama2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vama2 d.79.2.0 (A:209-315) automated matches {Bacillus subtilis [TaxId: 1423]} ldfadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggt nlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatgf
Timeline for d2vama2: