SCOPe 2.08: Domain d2vama2: 2vam A:209-315

Lineage for d2vama2 (2vam A:209-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.0: automated matches [227141] (1 protein)
   not a true family

6. Protein automated matches [226843] (9 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [225339] (3 PDB entries)

8. Domain d2vama2: 2vam A:209-315 [206283]
   Other proteins in same PDB: d2vama1
   automated match to d1rq2a2
   complexed with so4

Details for d2vama2

PDB Entry: 2vam, 2.5 Å

PDB Description: ftsz b. subtilis

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2vama2:

Sequence; same for both SEQRES and ATOM records:

>d2vama2 d.79.2.0 (A:209-315) automated matches {Bacillus subtilis [TaxId: 1423]}
ldfadvktimsnkgsalmgigiatgenraaeaakkaissplleaaidgaqgvlmnitggt
nlslyevqeaadivasasdqdvnmifgsvinenlkdeivvtviatgf

Timeline for d2vama2:

• d2vama2 first appeared in SCOPe 2.03
  
• d2vama2 appears in SCOPe 2.07