Lineage for d2rjka_ (2rjk A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779444Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 1779445Protein automated matches [190873] (3 species)
    not a true protein
  7. 1779446Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries)
  8. 1779469Domain d2rjka_: 2rjk A: [206136]
    automated match to d2re9a_
    mutant

Details for d2rjka_

PDB Entry: 2rjk (more details), 2.3 Å

PDB Description: crystal structure of human tl1a extracellular domain c95s mutant
PDB Compounds: (A:) TNF superfamily ligand TL1A

SCOPe Domain Sequences for d2rjka_:

Sequence, based on SEQRES records: (download)

>d2rjka_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdkprahltvvrqtptqhfknqfpalhwehelglaftknrmnytnkfllipesgdyfiys
qvtfrgmtsesseirqagrpnkpdsitvvitkvtdsypeptqllmgtksvcevgsnwfqp
iylgamfslqegdklmvnvsdislvdytkedktffgafll

Sequence, based on observed residues (ATOM records): (download)

>d2rjka_ b.22.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdkprahltvvrqtptqfpalhwehelglaftknrmnytnkfllipesgdyfiysqvtfr
gmkpdsitvvitkvtdsypeptqllmgtksvcevgsnwfqpiylgamfslqegdklmvnv
sdislvdytkedktffgafll

SCOPe Domain Coordinates for d2rjka_:

Click to download the PDB-style file with coordinates for d2rjka_.
(The format of our PDB-style files is described here.)

Timeline for d2rjka_: