Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries) |
Domain d2qhla_: 2qhl A: [205812] automated match to d1cd0b_ |
PDB Entry: 2qhl (more details), 1.56 Å
SCOPe Domain Sequences for d2qhla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qhla_ b.1.1.0 (A:) automated matches {Ictalurus punctatus [TaxId: 7998]} dikelhvktvkrgenvtmecsmskvkdkdklawyrqsfgkvpqyfvryyssnsgykfaeg fkdsrfsmtvndqkfdlniigtreddggeyfcgevegntikftsgtrlqf
Timeline for d2qhla_:
View in 3D Domains from other chains: (mouse over for more information) d2qhlb_, d2qhlc_, d2qhld_, d2qhle_ |