SCOPe 2.05: Domain d2qhlb_: 2qhl B:

Lineage for d2qhlb_ (2qhl B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Ictalurus punctatus [TaxId:7998] [225469] (6 PDB entries)

8. Domain d2qhlb_: 2qhl B: [205813]
   automated match to d1cd0b_

Details for d2qhlb_

PDB Entry: 2qhl, 1.56 Å

PDB Description: crystal structure of novel immune-type receptor 10 extracellular fragment from ictalurus punctatus

PDB Compounds: (B:) Novel immune-type receptor 10

SCOPe Domain Sequences for d2qhlb_:

Sequence; same for both SEQRES and ATOM records:

>d2qhlb_ b.1.1.0 (B:) automated matches {Ictalurus punctatus [TaxId: 7998]}
dikelhvktvkrgenvtmecsmskvkdkdklawyrqsfgkvpqyfvryyssnsgykfaeg
fkdsrfsmtvndqkfdlniigtreddggeyfcgevegntikftsgtrlqf

Timeline for d2qhlb_:

• d2qhlb_ first appeared in SCOPe 2.03
  
• d2qhlb_ appears in SCOPe 2.04
  
• d2qhlb_ appears in SCOPe 2.06
  
• d2qhlb_ appears in the current release, SCOPe 2.08