Lineage for d1mcoh1 (1mco H:1-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021759Species Human (Homo sapiens), cluster 2.2 [TaxId:9606] [88546] (2 PDB entries)
  8. 2021761Domain d1mcoh1: 1mco H:1-117 [20564]
    Other proteins in same PDB: d1mcoh2, d1mcoh3, d1mcoh4, d1mcol1, d1mcol2
    part of intact antibody MCG

Details for d1mcoh1

PDB Entry: 1mco (more details), 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion
PDB Compounds: (H:) igg1 mcg intact antibody (heavy chain)

SCOPe Domain Sequences for d1mcoh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcoh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.2 [TaxId: 9606]}
plvlqesgpglvkpsealsltctvsgdsintilyywswirqppgkglewigyiyysgsty
gnpslksrvtisvntsknqfysklssvtaadtavyycarvplvvnpwgqgtlvtvss

SCOPe Domain Coordinates for d1mcoh1:

Click to download the PDB-style file with coordinates for d1mcoh1.
(The format of our PDB-style files is described here.)

Timeline for d1mcoh1: