SCOPe 2.06: Domain d1mcoh4: 1mco H:328-428

Lineage for d1mcoh4 (1mco H:328-428)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88590] (67 PDB entries)
   Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region

8. Domain d1mcoh4: 1mco H:328-428 [21471]
   Other proteins in same PDB: d1mcoh1, d1mcoh2, d1mcoh3, d1mcol1, d1mcol2
   part of intact antibody MCG

Details for d1mcoh4

PDB Entry: 1mco, 3.2 Å

PDB Description: three-dimensional structure of a human immunoglobulin with a hinge deletion

PDB Compounds: (H:) igg1 mcg intact antibody (heavy chain)

SCOPe Domain Sequences for d1mcoh4:

Sequence; same for both SEQRES and ATOM records:

>d1mcoh4 b.1.1.2 (H:328-428) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
prepqvytlppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdg
sfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

Timeline for d1mcoh4:

• d1mcoh4 first appeared (with stable ids) in SCOP 1.55
  
• d1mcoh4 appears in SCOPe 2.05
  
• d1mcoh4 appears in SCOPe 2.07
  
• d1mcoh4 appears in the current release, SCOPe 2.08