SCOPe 2.06: Domain d2ppia1: 2ppi A:6-125

Lineage for d2ppia1 (2ppi A:6-125)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries)

8. Domain d2ppia1: 2ppi A:6-125 [205587]
   Other proteins in same PDB: d2ppia2
   automated match to d2nn2a_

Details for d2ppia1

PDB Entry: 2ppi, 2.4 Å

PDB Description: structure of the btb (tramtrack and bric a brac) domain of human gigaxonin

PDB Compounds: (A:) Gigaxonin

SCOPe Domain Sequences for d2ppia1:

Sequence, based on SEQRES records:

>d2ppia1 d.42.1.0 (A:6-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avsdpqhaarllralssfreesrfcdahlvldgeeipvqknilaaaspyirtklnynppk
ddgstykielegisvmvmreildyifsgqirlnedtiqdvvqaadlllltdlktlccefl

Sequence, based on observed residues (ATOM records):

>d2ppia1 d.42.1.0 (A:6-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avsdpqhaarllralssfrerfcdahlvldgeeipvqknilaaaspyirtklnynpstyk
ielegisvmvmreildyifsgqirlnedtiqdvvqaadlllltdlktlccefl

Timeline for d2ppia1:

• d2ppia1 first appeared in SCOPe 2.03, called d2ppia_
  
• d2ppia1 was called d2ppia_ in SCOPe 2.05
  
• d2ppia1 appears in SCOPe 2.07
  
• d2ppia1 appears in the current release, SCOPe 2.08