Lineage for d2nn2a_ (2nn2 A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.42: POZ domain [54694] (1 superfamily)
core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143Superfamily d.42.1: POZ domain [54695] (3 families) 
Family d.42.1.0: automated matches [191460] (1 protein)
not a true familyProtein automated matches [190710] (3 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187857] (39 PDB entries) 
Domain d2nn2a_: 2nn2 A: [166308]
automated match to d1buoa_
Details for d2nn2a_
PDB Entry: 2nn2 (more details), 2.1 Å
PDB Description: Crystal structure of the BTB domain from the LRF/ZBTB7 transcriptional regulator
PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 7ASCOPe Domain Sequences for d2nn2a_:
Sequence, based on SEQRES records: (download)
>d2nn2a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpigipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsg
avvdqqnvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadl
ldr
Sequence, based on observed residues (ATOM records): (download)
>d2nn2a_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpigipfpdhssdilsglneqrtqgllcdvvilvegrefpthrsvlaacsqyfkklftsq
nvyeidfvsaealtalmdfaytatltvstanvgdilsaarlleipavshvcadlldr
SCOPe Domain Coordinates for d2nn2a_:
Click to download the PDB-style file with coordinates for d2nn2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2nn2a_:
- d2nn2a_ first appeared in SCOPe 2.01
- d2nn2a_ appears in SCOPe 2.05
- d2nn2a_ appears in SCOPe 2.07
- d2nn2a_ appears in the current release, SCOPe 2.08
View in 3D
