Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (78 species) not a true protein |
Species Mesorhizobium loti [TaxId:266835] [225267] (1 PDB entry) |
Domain d2poze2: 2poz E:119-384 [205580] Other proteins in same PDB: d2poza1, d2poza3, d2pozb1, d2pozb3, d2pozc1, d2pozc3, d2pozd1, d2pozd3, d2poze1, d2poze3, d2pozf1, d2pozf3, d2pozg1, d2pozg3, d2pozh1, d2pozh3 automated match to d2gl5a1 |
PDB Entry: 2poz (more details), 2.04 Å
SCOPe Domain Sequences for d2poze2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2poze2 c.1.11.0 (E:119-384) automated matches {Mesorhizobium loti [TaxId: 266835]} kirdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsms aeaielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfd ngalkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamae aynmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyf empngpglgavlikrniepylwasct
Timeline for d2poze2: