SCOPe 2.07: Domain d2pozb1: 2poz B:4-118

Lineage for d2pozb1 (2poz B:4-118)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Mesorhizobium loti [TaxId:266835] [225266] (1 PDB entry)

8. Domain d2pozb1: 2poz B:4-118 [205573]
   Other proteins in same PDB: d2poza2, d2poza3, d2pozb2, d2pozb3, d2pozc2, d2pozc3, d2pozd2, d2pozd3, d2poze2, d2poze3, d2pozf2, d2pozf3, d2pozg2, d2pozg3, d2pozh2, d2pozh3
   automated match to d2gl5a2

Details for d2pozb1

PDB Entry: 2poz, 2.04 Å

PDB Description: crystal structure of a putative dehydratase from mesorhizobium loti

PDB Compounds: (B:) Putative dehydratase

SCOPe Domain Sequences for d2pozb1:

Sequence; same for both SEQRES and ATOM records:

>d2pozb1 d.54.1.0 (B:4-118) automated matches {Mesorhizobium loti [TaxId: 266835]}
kitgvniyllksgrlhpvlveistdegitgageagiaygvggtaaagmikdlserfligk
dpsrieelwstmydhsfwaknggaiifagisaieqalwdikgkclgvpvyelfgg

Timeline for d2pozb1:

• d2pozb1 first appeared in SCOPe 2.03
  
• d2pozb1 appears in SCOPe 2.06
  
• d2pozb1 appears in the current release, SCOPe 2.08