Lineage for d2poze2 (2poz E:119-384)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837587Species Mesorhizobium loti [TaxId:266835] [225267] (1 PDB entry)
  8. 2837592Domain d2poze2: 2poz E:119-384 [205580]
    Other proteins in same PDB: d2poza1, d2poza3, d2pozb1, d2pozb3, d2pozc1, d2pozc3, d2pozd1, d2pozd3, d2poze1, d2poze3, d2pozf1, d2pozf3, d2pozg1, d2pozg3, d2pozh1, d2pozh3
    automated match to d2gl5a1

Details for d2poze2

PDB Entry: 2poz (more details), 2.04 Å

PDB Description: crystal structure of a putative dehydratase from mesorhizobium loti
PDB Compounds: (E:) Putative dehydratase

SCOPe Domain Sequences for d2poze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2poze2 c.1.11.0 (E:119-384) automated matches {Mesorhizobium loti [TaxId: 266835]}
kirdrvrayangwygaadtpdefaraverplkegygalkfyplaqrvgsalqhvtrrsms
aeaielayrrvkavrdaagpeielmvdlsgglttdetirfcrkigeldicfveepcdpfd
ngalkviseqiplpiavgervytrfgfrkifelqacgiiqpdigtagglmetkkicamae
aynmrvaphvcgsslietatlqleanitnfmihehypafkaddgyvevlenppsissgyf
empngpglgavlikrniepylwasct

SCOPe Domain Coordinates for d2poze2:

Click to download the PDB-style file with coordinates for d2poze2.
(The format of our PDB-style files is described here.)

Timeline for d2poze2: