SCOPe 2.05: Domain d2pmuf_: 2pmu F:

Lineage for d2pmuf_ (2pmu F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (14 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225356] (2 PDB entries)

8. Domain d2pmuf_: 2pmu F: [205548]
   automated match to d1gxpb_
   complexed with cl, gly, k, po4, unx

Details for d2pmuf_

PDB Entry: 2pmu, 1.78 Å

PDB Description: crystal structure of the dna-binding domain of phop

PDB Compounds: (F:) response regulator PHOP

SCOPe Domain Sequences for d2pmuf_:

Sequence, based on SEQRES records:

>d2pmuf_ a.4.6.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
nvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvwrydf
ggdvnvvesyvsylrrkidtgekrllhtlrgvgyvlrep

Sequence, based on observed residues (ATOM records):

>d2pmuf_ a.4.6.0 (F:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
nvrltfadieldeethevwkagqpvslspteftllryfvinagtvlskpkildhvwdvnv
vesyvsylrrkidtgekrllhtlrgvgyvlrep

Timeline for d2pmuf_:

• d2pmuf_ first appeared in SCOPe 2.03
  
• d2pmuf_ appears in SCOPe 2.04
  
• d2pmuf_ appears in SCOPe 2.06
  
• d2pmuf_ appears in the current release, SCOPe 2.08