Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.1: Enolase [51605] (2 proteins) automatically mapped to Pfam PF00113 |
Protein Enolase [51606] (9 species) Fold of this protein slightly differs from common fold in topology |
Species Methanocaldococcus jannaschii [TaxId:2190] [225343] (1 PDB entry) |
Domain d2pa6b2: 2pa6 B:147-427 [205486] Other proteins in same PDB: d2pa6a1, d2pa6b1 automated match to d1pdza1 |
PDB Entry: 2pa6 (more details), 1.85 Å
SCOPe Domain Sequences for d2pa6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pa6b2 c.1.11.1 (B:147-427) Enolase {Methanocaldococcus jannaschii [TaxId: 2190]} vmpvpmmnvinggkhagndldlqefmimpvgatsiseavrmgsevyhvlknvilekygkn avnvgdeggfapplktsrealdlltesvkkagyedevvfaldaaasefykdgyyyvegkk ltreelldyykalvdeypivsiedpfheedfegfamitkeldiqivgddlfvtnverlrk giemkaanalllkvnqigtlseavdaaqlafrngygvvvshrsgetedttiadlsvalns gqiktgapargertakynqlirieqelglskyagrnfrcpf
Timeline for d2pa6b2: