Lineage for d1pdza1 (1pdz A:140-433)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823471Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 1823472Protein Enolase [51606] (9 species)
    Fold of this protein slightly differs from common fold in topology
  7. 1823513Species European lobster (Homarus vulgaris) [TaxId:6707] [51608] (2 PDB entries)
  8. 1823514Domain d1pdza1: 1pdz A:140-433 [29215]
    Other proteins in same PDB: d1pdza2
    complexed with mn, pga

Details for d1pdza1

PDB Entry: 1pdz (more details), 2.2 Å

PDB Description: x-ray structure and catalytic mechanism of lobster enolase
PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d1pdza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdza1 c.1.11.1 (A:140-433) Enolase {European lobster (Homarus vulgaris) [TaxId: 6707]}
devilpvpafnvinggshagnklamqefmilptgatsfteamrmgtevyhhlkavikarf
gldatavgdeggfapnilnnkdaldliqeaikkagytgkieigmdvaasefykqnniydl
dfktanndgsqkisgdqlrdmymefckdfpivsiedpfdqddwetwskmtsgttiqivgd
dltvtnpkrittavekkackclllkvnqigsvtesidahllakkngwgtmvshrsgeted
cfiadlvvglctgqiktgapcrserlakynqilrieeelgsgakfagknfraps

SCOPe Domain Coordinates for d1pdza1:

Click to download the PDB-style file with coordinates for d1pdza1.
(The format of our PDB-style files is described here.)

Timeline for d1pdza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pdza2