Lineage for d2o56g1 (2o56 G:1-122)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413262Species Salmonella typhimurium [TaxId:99287] [225193] (1 PDB entry)
  8. 1413269Domain d2o56g1: 2o56 G:1-122 [205223]
    Other proteins in same PDB: d2o56a2, d2o56b2, d2o56c2, d2o56d2, d2o56e2, d2o56f2, d2o56g2, d2o56h2
    automated match to d2gl5a2
    complexed with mg

Details for d2o56g1

PDB Entry: 2o56 (more details), 2 Å

PDB Description: crystal structure of a member of the enolase superfamily from salmonella typhimurium
PDB Compounds: (G:) Putative mandelate racemase

SCOPe Domain Sequences for d2o56g1:

Sequence, based on SEQRES records: (download)

>d2o56g1 d.54.1.0 (G:1-122) automated matches {Salmonella typhimurium [TaxId: 99287]}
lmkitsvdiidvandfasatskwrpvvvkintdegisgfgevglaygvgasagigmakdl
saiiigmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykml
gg

Sequence, based on observed residues (ATOM records): (download)

>d2o56g1 d.54.1.0 (G:1-122) automated matches {Salmonella typhimurium [TaxId: 99287]}
lmkitsvdiidvandfkwrpvvvkintdegisgfgevglaygvgasagigmakdlsaiii
gmdpmnneaiwekmlkktfwgqggggifsaamsgidialwdikgkawgvplykmlgg

SCOPe Domain Coordinates for d2o56g1:

Click to download the PDB-style file with coordinates for d2o56g1.
(The format of our PDB-style files is described here.)

Timeline for d2o56g1: