Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (45 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [225194] (1 PDB entry) |
Domain d2o56d2: 2o56 D:123-397 [205218] Other proteins in same PDB: d2o56a1, d2o56b1, d2o56c1, d2o56d1, d2o56e1, d2o56f1, d2o56g1, d2o56h1 automated match to d2gl5a1 complexed with mg |
PDB Entry: 2o56 (more details), 2 Å
SCOPe Domain Sequences for d2o56d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o56d2 c.1.11.0 (D:123-397) automated matches {Salmonella typhimurium [TaxId: 99287]} ksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnw nqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgif yyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggit evkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtcky nylpkngmyevpelpgigqelteetmkksptitvk
Timeline for d2o56d2: