SCOPe 2.03: Domain d2o56h2: 2o56 H:123-397

Lineage for d2o56h2 (2o56 H:123-397)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [225194] (1 PDB entry)

8. Domain d2o56h2: 2o56 H:123-397 [205226]
   Other proteins in same PDB: d2o56a1, d2o56b1, d2o56c1, d2o56d1, d2o56e1, d2o56f1, d2o56g1, d2o56h1
   automated match to d2gl5a1
   complexed with mg

Details for d2o56h2

PDB Entry: 2o56, 2 Å

PDB Description: crystal structure of a member of the enolase superfamily from salmonella typhimurium

PDB Compounds: (H:) Putative mandelate racemase

SCOPe Domain Sequences for d2o56h2:

Sequence; same for both SEQRES and ATOM records:

>d2o56h2 c.1.11.0 (H:123-397) automated matches {Salmonella typhimurium [TaxId: 99287]}
ksrekirtyasqlqfgwgdgsdkdmltepeqyaqaaltavsegydaikvdtvamdrhgnw
nqqnlngpltdkilrlgydrmaairdavgpdvdiiaemhaftdttsaiqfgrmieelgif
yyeepvmplnpaqmkqvadkvniplaageriywrwgyrpflengslsviqpdictcggit
evkkicdmahvydktvqihvcggpistavalhmetaipnfvihelhryallepntqtcky
nylpkngmyevpelpgigqelteetmkksptitvk

Timeline for d2o56h2:

• d2o56h2 is new in SCOPe 2.03-stable
  
• d2o56h2 appears in SCOPe 2.04
  
• d2o56h2 appears in the current release, SCOPe 2.08