Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (5 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [225183] (1 PDB entry) |
Domain d2nv5a_: 2nv5 A: [205182] automated match to d2ooqb_ |
PDB Entry: 2nv5 (more details), 2 Å
SCOPe Domain Sequences for d2nv5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nv5a_ c.45.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} shppipileladhierlkandnlkfsqeyesidpgqqftwehsnlevnkpknryanviay dhsrvllsaiegipgsdyvnanyidgyrkqnayiatqgslpetfgdfwrmiweqrsatvv mmtkleersrvkcdqywpsrgtethglvqvtlldtvelatycvrtfalykngssekrevr qfqftawpdhgvpehptpflaflrrvktcnppdagpmvvhcsagvgrtgcfividamler ikhektvdiyghvtlmraqrnymvqtedqyifihdalleavtc
Timeline for d2nv5a_: