SCOP 1.63: Domain d1vhp__: 1vhp -

Lineage for d1vhp__ (1vhp -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species VH-P8 domain (human), camelized monomer [48913] (1 PDB entry)

8. Domain d1vhp__: 1vhp - [20504]

Details for d1vhp__

PDB Entry: 1vhp

PDB Description: vh-p8, nmr

SCOP Domain Sequences for d1vhp__:

Sequence; same for both SEQRES and ATOM records:

>d1vhp__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {VH-P8 domain (human), camelized monomer}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss

Timeline for d1vhp__:

• d1vhp__ first appeared (with stable ids) in SCOP 1.55
  
• d1vhp__ appears in SCOP 1.61
  
• d1vhp__ appears in SCOP 1.65
  
• d1vhp__ appears in the current release, SCOPe 2.08, called d1vhpa_