Lineage for d1vhp__ (1vhp -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) 
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) 
Species VH-P8 domain (human), camelized monomer [48913] (1 PDB entry) 
Domain d1vhp__: 1vhp - [20504]
Details for d1vhp__
PDB Entry: 1vhp (more details)
PDB Description: vh-p8, nmr
SCOP Domain Sequences for d1vhp__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhp__ b.1.1.1 (-) Immunoglobulin (variable domains of L and H chains) {VH-P8 domain (human), camelized monomer}
evqlvesggglvqpggslrlscaasgftfssyamswvrqapgkereivsavsgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycarlkkyafdywgqgtlvtvss
SCOP Domain Coordinates for d1vhp__:
Click to download the PDB-style file with coordinates for d1vhp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vhp__:
- d1vhp__ first appeared (with stable ids) in SCOP 1.55
- d1vhp__ appears in SCOP 1.59
- d1vhp__ appears in SCOP 1.63
- d1vhp__ appears in the current release, SCOPe 2.08, called d1vhpa_
View in 3D